PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.005G150900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family GRF
Protein Properties Length: 372aa    MW: 40012.7 Da    PI: 8.5876
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.005G150900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.26e-23129173145
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                           daepgrCrRtDGKkWRCsr++++++k+CErH++rg++rsrk++e 
  Sobic.005G150900.1.p 129 DAEPGRCRRTDGKKWRCSRDAVGDQKYCERHIKRGCHRSRKHVEG 173
                           79****************************************996 PP

2QLQ575.8e-2069105137
                   QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                           ++FT++Q+++L++Q+l+yK++a n+PvP+ Ll++i++
  Sobic.005G150900.1.p  69 GPFTPTQWMELEHQALIYKHFAVNAPVPSSLLLPIKR 105
                           59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.8E-1269105IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-1370103IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.30870105IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.668129173IPR014977WRC domain
PfamPF088795.7E-18130172IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MERGGRDVFL GPTPPPPPSC PFHGSATAAR SGGAQMLSFS SSSPSNGAVG LGLCSGASKM  60
QSVLSRVRGP FTPTQWMELE HQALIYKHFA VNAPVPSSLL LPIKRSLNPW SSLGSSSLGW  120
APFRSGSGDA EPGRCRRTDG KKWRCSRDAV GDQKYCERHI KRGCHRSRKH VEGRKATPTI  180
ADPTMVVSGG SLLYSHAVTW QQQAKSSAAN VADPFSLGSN RNLLDKQNIG DQFSVSTSMD  240
SFDFSASHSS PNHDKVAFSP VEMQHEHDQL YLVHGAGSSA EHVNKSQDGQ LLVSRETIDD  300
GPLGEVFKGK SCQSASADIL TDQWTSTCEL HSPTGILQMS SSNRVTVENH TSNNSYLMAR  360
MVNSHTVPTL H*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0687000.0BT068700.1 Zea mays full-length cDNA clone ZM_BFb0375O24 mRNA, complete cds.
GenBankEU9546450.0EU954645.1 Zea mays clone 1475381 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001106041.10.0putative growth-regulating factor 2
SwissprotQ6AWY11e-146GRF8_ORYSJ; Growth-regulating factor 8
TrEMBLB6SPI00.0B6SPI0_MAIZE; GRF transcription factor
STRINGSb05g021480.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129602731
Representative plantOGRP1468944
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-40growth-regulating factor 2